SDF-1 (S821-40N)

SDF-1 (S821-40N)

  • $204.00


FOR BULK ORDER REQUESTS PLEASE CONTACT US

Description : This highly active SDF-1 contains 69 amino acids (MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK), which was derived from SDF-1-beta (3-72) and SDF-1-alpha (3-67). The SDF-1 protein was expressed in E. coli cells and purified by proprietary chromatographic techniques.

Purity : Sample Purity Data. For specific information on a given lot, see related technical data sheet. 

Storage, Stability and Shipping : Stored at desiccated below -20oC. It is stable at 4oC between 2-7 days. For long term storage, aliquot target into smaller quantities after centrifugation and store at recommended temperature. For most favorable performance, avoid repeated handling and multiple freeze/thaw cycles.

Applications :  Cell Assay

Endotoxin Level :  Less than 0.1 ng/ug (IEU/ug) of SDF-1.

Molecular Weight : ~10.5 kDa

Gene Aliases : none

Scientific Background : SDF-1 or stromal cell derived factor 1 is a member of the intercrine family which activate lymphocytes and have been used in the metastasis of some cancers such as breast cancer. SDF-1 is a chemokine receptor involved in a number of pathobiologic processes, including cell growth, survival, and adhesion, as well as tumor growth (1). SDF-1 plays a major role in the etiology of benign proliferative disease in an aging tissue microenvironment (2).

References : 
1. Burns, J. M. et.al: A novel chemokine receptor for SDF-1 and I-TAC involved in cell survival, cell adhesion, and tumor development. J. Exp. Med. 203: 2201-2213, 2006.

2. Begley, L. A. et.al: CXCL12 activates a robust transcriptional response in human prostate epithelial cells. J. Biol. Chem. 282: 26767-26774, 2007.

Product Sheets: (by Lot #):

I123-3.pdf

Research Areas : AKT/PKB Pathway, Cancer, ERK/MAPK Pathway, Inflammation, Invasion/Metastasis, JNK/SAPK Pathway, NfkB Pathway, p38 Pathway, PKA/PKC Pathway,