Due to Easter holiday, all delivery service requests will not be processed on Friday, April 10, 2020. Regular delivery schedule will resume on Monday, April 13, 2019.


  • $105.00


Description :The 39 amino acids of PDKtide peptide sequence (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).

Species :

Tag :

Expression System:


Purity :Determined to be 105% by HPLC analysis.

Storage, Stability and Shipping :Store product at –20oC. For optimal storage, aliquot diluted product into smaller quantities and store at recommended temperature. For most favorable performance, avoid repeated handling and multiple freeze/thaw cycles.

Applications :Kinase Assay

Molecular Weight :4771.36

Product Sheets (By Lot #) :


Research Areas :Cancer, Neurobiology, Inflammation, Metabolic Disorder, Cardiovascular Disease, AKT/PKB Pathway, NfkB Pathway, WNT Signaling, Apoptosis/Autophagy, Angiogenesis, Invasion/Metastasis, Cancer, Neurobiology, Inflammation, Metabolic Disorder, Cardiovascular Disease, AKT/PKB Pathway, NfkB Pathway, WNT Signaling, Apoptosis/Autophagy, Angiogenesis, Invasion/Metastasis, Ser/Thr Kinases